Recombinant Human Bcl-2-Like Protein 1/BCL2L1

Instruction Manual!

Product name:	Recombinant Human Bcl-2-Like Protein 1/BCL2L1
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM HEPES, 50mM KCl, 20% Glycerol, pH 7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Bcl-2-Like Protein 1 is produced by our E.coli expression system and the target gene encoding Met1-Arg212 is expressed with a 6His tag at the C-terminus.
Names	Bcl-2-Like Protein 1, Bcl2-L-1, Apoptosis Regulator Bcl-X, BCL2L1, BCL2L, BCLX
Accession #	Q07817
Formulation	Supplied as a 0.2 μm filtered solution of 20mM HEPES, 50mM KCl, 20% Glycerol, pH 7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAV NGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNEL FRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELY GNNAAAESRKGQERFNRLEHHHHHH
Background	Bcl-2-Like Protein 1 (BCL2L1) is a member of the Bcl-2 family. BCL2L1 is expressed at high levels in cells that undergo a high rate of turnover, such as developing lymphocytes. BCL2L1 is a mitochondrial membrane protein. BCL2L1 contains four motifs, BH1, BH2 and BH4. The BH4 motif is required for anti-apoptotic activity. The BH1 and BH2 motifs are required for both heterodimerization with other Bcl-2 family members and for repression of cell death. BCL2L1 regulates cell death by blocking the voltage-dependent anion channnel (VDAC) and preventing the release of the caspase activator, CYC1, from the mitochondrial membrane. In addition, BCL2L1 promotes apoptosis.