Recombinant Human Chymotrypsin-Like Protease CTRL-1/CTRL
| Product name: | Recombinant Human Chymotrypsin-Like Protease CTRL-1/CTRL |
| Source: | Human Cells |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 10% Glycerol, pH 8.0. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | Human Cells |
| Description | Recombinant Human CTRL is produced by our Mammalian expression system and the target gene encoding Cys19-Asn264 is expressed with a 6His tag at the C-terminus. |
| Names | Chymotrypsin-Like Protease CTRL-1, CTRL, CTRL1 |
| Accession # | P40313 |
| Formulation | Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 10% Glycerol, pH 8.0. |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
CGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRH FVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEA LTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGD SGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYNVDHHHHHH
|
| Background | Chymotrypsin-Like Protease CTRL-1 is a protease that belongs to the peptidase S1 family. Human CTRL-1 is synthesized as a 264 amino acid (aa) precursor that contains an 18 aa signal sequence, 15 aa activation peptide and a 231 aa mature chain. CTRL-1 Contains 1 peptidase S1 domain. It has many molecular functions, such as hydrolase, protease, and serine protease. CTRL-1 plays a role in digest and hydrolyze proteins in biological process. |












