Recombinant Human Butyrophilin 1A1/BTN1A1

Instruction Manual!

Product name:	Recombinant Human Butyrophilin 1A1/BTN1A1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Butyrophilin 1A1 is produced by our Mammalian expression system and the target gene encoding Ala27-Arg242 is expressed with a 6His tag at the C-terminus.
Names	Butyrophilin Subfamily 1 Member A1, BT, BTN1A1, BTN
Accession #	Q13410
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	APFDVIGPPEPILAVVGEDAELPCRLSPNASAEHLELRWFRKKVSPAVLVHRDGREQEAEQMPEY RGRATLVQDGIAKGRVALRIRGVRVSDDGEYTCFFREDGSYEEALVHLKVAALGSDPHISMQVQE NGEICLECTSVGWYPEPQVQWRTSKGEKFPSTSESRNPDEEGLFTVAASVIIRDTSAKNVSCYIQ NLLLGQEKKVEISIPASSLPRVDHHHHHH
Background	Butyrophilin Subfamily 1 Member A1 (BTN1A1) is the major protein associated with fat droplets in the milk. It belongs the immunoglobulin superfamily. BTN1A1 acts as a specific membrane-associated receptor for the association of cytoplasmic droplets with the apical plasma membrane. It is localized to the major histocompatibility complex (MHC) class I region of 6p. It may have arisen relatively recently in evolution by the shuffling of exons between 2 ancestral gene families. It is shown that BTN1A1 inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion.