Recombinant Human Complement Factor H-Related Protein 2/CFHR2

Instruction Manual!

Product name:	Recombinant Human Complement Factor H-Related Protein 2/CFHR2
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human CFHR2 is produced by our Mammalian expression system and the target gene encoding Glu19-Lys270 is expressed with a 6His tag at the C-terminus.
Names	Complement Factor H-Related Protein 2, FHR-2, DDESK59, H Factor-Like 3, H Factor-Like Protein 2, CFHR2, CFHL2, FHR2, HFL3
Accession #	P36980
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	EAMFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCAEEGWSPTPKC LRLCFFPFVENGHSESSGQTHLEGDTVQIICNTGYRLQNNENNISCVERGWSTPPKCRSTISAEK CGPPPPIDNGDITSFLLSVYAPGSSVEYQCQNLYQLEGNNQITCRNGQWSEPPKCLDPCVISQEI MEKYNIKLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEEKVDHHHHHH
Background	Complement Factor H-Related Protein 2 (CFHR2) is a secreted protein that belongs to the complement factor H protein family. Members of the H-related protein family are exclusively composed of individually folded protein domains, termed short consensus repeats (SCRs) or complement control modules. CFHR2 is synthesized as a 270 amino acid precursor that contains an 18 amino acid signal peptide and a 252 amino acid mature chain with 4 Sushi (CCP/SCR) domains. CFHR2 is synthesized in the liver and secreted into plasma. It may be involved in complement regulation. CFHR2 can also be associated with lipoproteins and may play a role in lipid metabolism.