Recombinant Human Chymotrypsin-C/CTRC

Instruction Manual!

Product name:	Recombinant Human Chymotrypsin-C/CTRC
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Chymotrypsin-C is produced by our Mammalian expression system and the target gene encoding Cys17-Leu268 is expressed with a 6His tag at the C-terminus.
Names	Chymotrypsin-C, Caldecrin, CTRC, CLCR
Accession #	Q99895
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	CGVPSFPPNLSARVVGGEDARPHSWPWQISLQYLKNDTWRHTCGGTLIASNFVLTAAHCISNTRT YRVAVGKNNLEVEDEEGSLFVGVDTIHVHKRWNALLLRNDIALIKLAEHVELSDTIQVACLPEKD SLLPKDYPCYVTGWGRLWTNGPIADKLQQGLQPVVDHATCSRIDWWGFRVKKTMVCAGGDGVISA CNGDSGGPLNCQLENGSWEVFGIVSFGSRRGCNTRKKPVVYTRVSAYIDWINEKMQLVDHHHHHH
Background	Chymotrypsin C (CTRC) is a member of the peptidase S1 family. CTRC is a serum calcium-decreasing factor that has chymotrypsin-like protease activity. CTRC has broad substrate specificity, but prefers tocleave on the carboxyl side of hydrophobic residues. CTRC is expressed primarily in the pancreas, and is secreted into the digestive tract. CTRC plays a protective role in the pancreas by mitigating premature trypsinogen activation through degradation. It has been proposed that CTRC is a key regulator of digestive zymogen activation and is a physiological coactivator of digestive carboxypeptidases proCPA1 and proCPA2. The mutation of CTRC gene encodes the digestive enzyme CTRC contribute to the development of pancreatitis.