Recombinant Human Serum Amyloid P-Component/Pentraxin 2/SAP

Instruction Manual!

Product name:	Recombinant Human Serum Amyloid P-Component/Pentraxin 2/SAP
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Serum Amyloid P Component is produced by our Mammalian expression system and the target gene encoding His20-Val223 is expressed with a 6His tag at the C-terminus.
Names	Serum Amyloid P-Component, SAP, 9.5S Alpha-1-Glycoprotein, APCS, PTX2
Accession #	P02743
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	HTDLSGKVFVFPRESVTDHVNLITPLEKPLQNFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYK ERVGEYSLYIGRHKVTSKVIEKFPAPVHICVSWESSSGIAEFWINGTPLVKKGLRQGYFVEAQPK IVLGQEQDSYGGKFDRSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPANILDWQALNYEIRGY VIIKPLVWVDHHHHHH
Background	Serum Amyoid P Component (SAP) is a monomeric 25 kDa secreted serum glycoprotein that belongs to the pentraxins family. The members of pentaxin superfamily be characterised by calcium dependent ligand binding and distinctive flattened β-jellyroll structure similar to that of the legume lectins. SAP is a non-fibrillar component, it can interact with DNA and histones. It regulates the solubility of amyloid fibrils and protects them from degradation by proteolytic enzymes and phagocytic cells. SAP scavenge nuclear material released from damaged circulating cells. It has been proposed that SAP may function as an opsonin for a variety of ligands including autoantigens, apoptotic cells, chromatin and micro-organisms.