Recombinant Human β-1,4-Galactosyltransferase 4/B4GALT4

Instruction Manual!

Product name:	Recombinant Human β-1,4-Galactosyltransferase 4/B4GALT4
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human B4GALT4 is produced by our Mammalian expression system and the target gene encoding Gln39-Ala344 is expressed with a 6His tag at the C-terminus.
Names	Beta-1,4-Galactosyltransferase 4, Beta-1,4-GalTase 4, Beta4Gal-T4, b4Gal-T4, UDP-Gal:Beta-GlcNAc Beta-1,4-Galactosyltransferase 4, UDP-Galactose:Beta-N-Acetylglucosamine Beta-1,4-Galactosyltransferase 4, B4GALT4
Accession #	O60513
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	QEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQA ENPKVSRGRYRPEECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKF NRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFG GVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVN AERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGAVDHHHHHH
Background	β-1,4-galactosyltransferase 4 (B4GALT4) is a single-pass type II membrane protein that belongs to the Glycosyltransferase 7 family. B4GALT4 consist of the following 2 domains: N-Acetyllactosamine Synthase and β-N-Acetylglucosaminyl-Glycolipid β-1,4-Galactosyltransferase. B4GALT4 is highly expressed in the heart, placenta, kidney, and pancreas; it is lowly expressed in the brain, colon, lung, muscle, ovary, testis, and uterus. B4GALT4 function is responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids.