Recombinant Human Cathepsin L2/CTSL2
| Product name: | Recombinant Human Cathepsin L2/CTSL2 |
| Source: | Human Cells |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Supplied as a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, pH 5.5. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | Human Cells |
| Description | Recombinant Human Cathepsin L2 is produced by our Mammalian expression system and the target gene encoding Val18-Val334 is expressed with a 6His tag at the C-terminus. |
| Names | Cathepsin L2, Cathepsin U, Cathepsin V, CTSL2, CATL2, CTSU, CTSV |
| Accession # | O60911 |
| Formulation | Supplied as a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, pH 5.5. |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
VPKFDQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELHNGEYSQGKHGFTMAMNAFGD MTNEEFRQMMGCFRNQKFRKGKVFREPLFLDLPKSVDWRKKGYVTPVKNQKQCGSCWAFSATGAL EGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICK YRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDH GVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNVVDHHHHHH
|
| Background | Cathepsin L2 belongs to the Peptidase C1 family. Cathepsin L2 can be autocatalytically convertedto the mature form as a proenzyme in lysosomes at pH=7.0. Cathepsin L2 cannot be expressed in normal mammary gland, colon and peritumoral tissue, but it can be expressed in breast carcinomas and colorectal tissues. These suggeats Cathepsin L2 may play a role in tumor processes. Cathepsin L2 is specifically expressed in the testis, thymus, and corneal epithelium. |












