Recombinant Human Cathepsin L2/CTSL2

Instruction Manual!

Product name:	Recombinant Human Cathepsin L2/CTSL2
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, pH 5.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Cathepsin L2 is produced by our Mammalian expression system and the target gene encoding Val18-Val334 is expressed with a 6His tag at the C-terminus.
Names	Cathepsin L2, Cathepsin U, Cathepsin V, CTSL2, CATL2, CTSU, CTSV
Accession #	O60911
Formulation	Supplied as a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, pH 5.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	VPKFDQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELHNGEYSQGKHGFTMAMNAFGD MTNEEFRQMMGCFRNQKFRKGKVFREPLFLDLPKSVDWRKKGYVTPVKNQKQCGSCWAFSATGAL EGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICK YRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDH GVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNVVDHHHHHH
Background	Cathepsin L2 belongs to the Peptidase C1 family. Cathepsin L2 can be autocatalytically convertedto the mature form as a proenzyme in lysosomes at pH=7.0. Cathepsin L2 cannot be expressed in normal mammary gland, colon and peritumoral tissue, but it can be expressed in breast carcinomas and colorectal tissues. These suggeats Cathepsin L2 may play a role in tumor processes. Cathepsin L2 is specifically expressed in the testis, thymus, and corneal epithelium.