Recombinant Human Brain Natriuretic Peptide/BNP

Instruction Manual!

Product name:	Recombinant Human Brain Natriuretic Peptide/BNP
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, 1mM DTT, 20% Glycerol, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Natriuretic Peptides B is produced by our E.coli expression system and the target gene encoding His27-His134 is expressed with a 6His tag at the N-terminus.
Names	Natriuretic Peptides B, Gamma-Brain Natriuretic Peptide, NPPB
Accession #	P16860
Formulation	Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, 1mM DTT, 20% Glycerol, pH 7.4.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQES PRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Background	Human Natriuretic peptides B acts as a cardiac hormone; it is associated with many biological actions, such as diuresis, natriuresis, vasorelaxation, which inhibits the secretion of rennin and aldosterone. It acts as a paracrine antifibrotic factor in the heart. Natriuretic peptides B can help restore the body balance of salt and water, improves the heart function. Natriuretic peptides B binds and stimulates the cGMP production of the NPR1 receptor and binds the clearance receptor NPR3.