elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human β-Lactamase-Like Protein 2/LACTB2

Recombinant Human β-Lactamase-Like Protein 2/LACTB2 Recombinant Human β-Lactamase-Like Protein 2/LACTB2

Instruction Manual!

Product name: Recombinant Human β-Lactamase-Like Protein 2/LACTB2
Source:E.coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, pH 7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E.coli
Description Recombinant Human LACTB2 is produced by our E.coli expression system and the target gene encoding Met1-Leu288 is expressed with a GST tag at the N-terminus.
Names Beta-Lactamase-Like Protein 2, LACTB2
Accession # Q53H82
Formulation Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, pH 7.4.
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKL TQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEML KMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKS SKYIAWPLQGWQATFGGGDHPPKSDLVPRGSHMAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNT YLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTT YCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSG DCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLF RENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL
Background β-Lactamase-like Protein 2 (LACTB2) is a number of the metallo-beta-lactamase superfamily.LACTB2 also belongs to the Glyoxalase II family. LACTB2 is 288 amino acids long with 8 zinc-binding domains. The LACTB2 gene is expressed at high levels and annotates structural defects or features in 4 cDNA clones. LACTB2 proteins are expected to have hydrolase activity and metal ion-binding functions. LACTB2 protein is found to localize in mitochondrion. Other functions of LACTB2 is yet unknown.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese