Recombinant Human β-Lactamase-Like Protein 2/LACTB2

Instruction Manual!

Product name:	Recombinant Human β-Lactamase-Like Protein 2/LACTB2
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human LACTB2 is produced by our E.coli expression system and the target gene encoding Met1-Leu288 is expressed with a GST tag at the N-terminus.
Names	Beta-Lactamase-Like Protein 2, LACTB2
Accession #	Q53H82
Formulation	Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, pH 7.4.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKL TQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEML KMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKS SKYIAWPLQGWQATFGGGDHPPKSDLVPRGSHMAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNT YLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTT YCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSG DCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLF RENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL
Background	β-Lactamase-like Protein 2 (LACTB2) is a number of the metallo-beta-lactamase superfamily.LACTB2 also belongs to the Glyoxalase II family. LACTB2 is 288 amino acids long with 8 zinc-binding domains. The LACTB2 gene is expressed at high levels and annotates structural defects or features in 4 cDNA clones. LACTB2 proteins are expected to have hydrolase activity and metal ion-binding functions. LACTB2 protein is found to localize in mitochondrion. Other functions of LACTB2 is yet unknown.