elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Nucleolar Protein 3/NOL3

Recombinant Human Nucleolar Protein 3/NOL3 Recombinant Human Nucleolar Protein 3/NOL3

Instruction Manual!

Product name: Recombinant Human Nucleolar Protein 3/NOL3
Source:E.coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Supplied as a 0.2 μm filtered solution of 25mM TrisHCl, 1mM DTT, 1mM EDTA, 2mM β-ME, 20% Glycerol, pH 7.5.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E.coli
Description Recombinant Human Nucleolar Protein 3 is produced by our E.coli expression system and the target gene encoding Met1-Ser208 is expressed.
Names Nucleolar Protein 3, Apoptosis Repressor With CARD, Muscle-Enriched Cytoplasmic Protein, Myp, Nucleolar Protein of 30 kDa, Nop30
Accession # O60936
Formulation Supplied as a 0.2 μm filtered solution of 25mM TrisHCl, 1mM DTT, 1mM EDTA, 2mM β-ME, 20% Glycerol, pH 7.5.
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLV QGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRA SDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEP EPDFEERDESEDS
Background Nucleolar protein 3 is encoded by NOL3 gene. Multiple transcript variants encoding different isoforms have been found for this gene. So far, Nucleolar protein 3 has show to have two Isoforms. Isoform 1 may be involved in RNA splicing.Isoform 2 may inhibit apoptosis.It has been shown to down-regulate the enzyme activities of caspase 2, caspase 8 and tumor protein p53.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese