Recombinant Human Biglycan/BGN

Instruction Manual!

Product name:	Recombinant Human Biglycan/BGN
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Biglycan is produced by our Mammalian expression system and the target gene encoding Glu20-Lys368 is expressed with a 6His tag at the C-terminus.
Names	Biglycan, Bone/Cartilage Proteoglycan I, PG-S1, BGN, SLRR1A
Accession #	P21810
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	EQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSV PKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNH LVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLR ISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTL RELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPY WEVQPATFRCVTDRLAIQFGNYKKVDHHHHHH
Background	Biglycan is a 200-350 kD proteoglycan consisting of a 45 kD core protein and two chrondroitin/dermatan sulfate glycosaminoglycan chains. Biglycan binds to TGF-ß. It also binds to collagen type I in low ionic strength (less than 3 mM phosphate) buffer. At higher ionic strengths, Biglycan does not bind to collagen type I. It enhances the inhibition effect of TGF-ß on osteoclast proliferation at a concentration of 4-20 mg/ml. It also prevents the attachment of CHO cells to fibronectin, with a 50% inhibition at 17-21 mg/ml.