Recombinant Human Lipopolysaccharide-Binding Protein/LBP

Instruction Manual!

Product name:	Recombinant Human Lipopolysaccharide-Binding Protein/LBP
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human LBP is produced by our Mammalian expression system and the target gene encoding Ala26-Val481 is expressed with a 6His tag at the C-terminus.
Names	Lipopolysaccharide-Binding Protein, LBP
Accession #	P18428
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	ANPGLVARITDKGLQYAAQEGLLALQSELLRITLPDFTGDLRIPHVGRGRYEFHSLNIHSCELLH SALRPVPGQGLSLSISDSSIRVQGRWKVRKSFFKLQGSFDVSVKGISISVNLLLGSESSGRPTVT ASSCSSDIADVEVDMSGDLGWLLNLFHNQIESKFQKVLESRICEMIQKSVSSDLQPYLQTLPVTT EIDSFADIDYSLVEAPRATAQMLEVMFKGEIFHRNHRSPVTLLAAVMSLPEEHNKMVYFAISDYV FNTASLVYHEEGYLNFSITDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLN FSPGNLSVDPYMEIDAFVLLPSSSKEPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKESK VGLFNAELLEALLNYYILNTFYPKFNDKLAEGFPLPLLKRVQLYDLGLQIHKDFLFLGANVQYMR VVDHHHHHH
Background	Lipopolysaccharide binding protein (LBP) is a plasma protein, belongs to a member of structurally and functionally related proteins which includes bactericidal permeability-increasing protein (BPI), plasma cholesteryl ester transfer protein (CETP) and phospholipid transfer protein (PLTP). It is involved in the acute-phase immunologic response to gram-negative bacterial infections. In cooperation with BPI. LBP binds LPS and interacts with the CD14 receptor, most likely playing a role in regulating LPS-dependent monocyte responses. Studies suggest that LBP is necessary for the rapid acute-phase response to LPS but not for the clearance of LPS from circulation. Finally, t The LBP gene is found on chromosome 20, directly downstream of the BPI gene.