Recombinant Human Legumain/Asparaginyl Endopeptidase

Instruction Manual!

Product name:	Recombinant Human Legumain/Asparaginyl Endopeptidase
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 10% Glycerol, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Legumain is produced by our Mammalian expression system and the target gene encoding Ile18-Tyr433 is expressed with a 6His tag at the C-terminus.
Names	Legumain, Asparaginyl Endopeptidase, Protease Cysteine 1, LGMN, PRSC1
Accession #	Q99538
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 10% Glycerol, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	IPIDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIVVMMYDDIAYSEDNPT PGIVINRPNGTDVYQGVPKDYTGEDVTPQNFLAVLRGDAEAVKGIGSGKVLKSGPQDHVFIYFTD HGSTGILVFPNEDLHVKDLNETIHYMYKHKMYRKMVFYIEACESGSMMNHLPDNINVYATTAANP RESSYACYYDEKRSTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKTIST MKVMQFQGMKRKASSPVPLPPVTHLDLTPSPDVPLTIMKRKLMNTNDLEESRQLTEEIQRHLDAR HLIEKSVRKIVSLLAASEAEVEQLLSERAPLTGHSCYPEALLHFRTHCFNWHSPTYEYALRHLYV LVNLCEKPYPLHRIKLSMDHVCLGHYVDHHHHHH
Background	Legumain is a lysosomal cysteine protease which is a member of the peptidase C13 family. Though it is found in many tissues, it is highly expressed in the kidney, heart, and placenta. Legumain has a strict specificity for hydrolysis of asparaginyl bonds and can also cleave aspartyl bonds slowly, especially under acidic conditions. Over-expression Legumain in tumors is significant for invasion and metastasis. In addition, Legumain may be involved in the processing of proteins for MHC class II antigen presentation in the lysosomal/endosomal system and negative regulation of neuron apoptosis.
References	A novel legumain protease-activated micelle cargo enhances anticancer activity and cellular internalization of doxorubicin