Recombinant Human Low-Density Lipoprotein Receptor Related Protein 12/LRP12

Instruction Manual!

Product name:	Recombinant Human Low-Density Lipoprotein Receptor Related Protein 12/LRP12
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human LRP12 is produced by our Mammalian expression system and the target gene encoding Asn28-Ile488 is expressed with a 6His tag at the C-terminus.
Names	Low-Density Lipoprotein Receptor-Related Protein 12, LRP-12, Suppressor of Tumorigenicity 7 Protein, LRP12, ST7
Accession #	Q9Y561
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	NGALAEHSENVHISGVSTACGETPEQIRAPSGIITSPGWPSEYPAKINCSWFIRANPGEIITISF QDFDIQGSRRCNLDWLTIETYKNIESYRACGSTIPPPYISSQDHIWIRFHSDDNISRKGFRLAYF SGKSEEPNCACDQFRCGNGKCIPEAWKCNNMDECGDSSDEEICAKEANPPTAAAFQPCAYNQFQC LSRFTKVYTCLPESLKCDGNIDCLDLGDEIDCDVPTCGQWLKYFYGTFNSPNYPDFYPPGSNCTW LIDTGDHRKVILRFTDFKLDGTGYGDYVKIYDGLEENPHKLLRVLTAFDSHAPLTVVSSSGQIRV HFCADKVNAARGFNATYQVDGFCLPWEIPCGGNWGCYTEQQRCDGYWHCPNGRDETNCTMCQKEE FPCSRNGVCYPRSDRCNYQNHCPNGSDEKNCFFCQPGNFHCKNNRCVFESWVCDSQDDCGDGSDE ENCPVIVDHHHHHH
Background	Low-Density Lipoprotein Receptor-Related Protein 12 (LRP12) belongs to the LDLR family. LRP12 is a type I transmembrane protein annd widely expressed in heart, skeletal muscle, brain, lung, placenta and pancreas. LRP12 contains 2 CUB domain and 5 LDL-receptor class A domain. LRP12 has been shown to interact with GNB2L1, ZFYVE9 and ITGB1BP3. LRP12 is a receptor probably, which may be involved in the internalization of lipophilic molecules and/or signal transduction. In addition, LRP12 may act as a tumor suppressor.