Recombinant Human Kallikrein 11/KLK11

Instruction Manual!

Product name:	Recombinant Human Kallikrein 11/KLK11
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 2mM CaCl2, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Kallikrein 11 is produced by our Mammalian expression system and the target gene encoding Glu19-Asn250 is expressed with a 6His tag at the C-terminus.
Names	Kallikrein-11, hK11, Hippostasin, Serine Protease 20, Trypsin-Like Protease, KLK11, PRSS20, TLSP
Accession #	Q9UBX7
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 2mM CaCl2, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	ETRIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTAAHCLKPRYIVHLGQHNLQKEEGC EQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWG STSSPQLRLPHTLRCANITIIEHQKCENAYPGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSL QGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMKNNVDHHHHHH
Background	Human Kallikrein 11 (KLK11) is a member of tissue kallikrein family which are extracellular serine proteases consisting of 15 members. Two isoforms of KLK11 are differentially expressed. Isoform 1 is predominantly expressed in brain and isoform 2 is preferentially expressed in prostate. Isoform 1 consists of a signal peptide,a short pro peptide and the mature chain.Isoform 2 contains an extra 32 amino acid N terminal to full-length isoform 1.KLK11 is a novel marker for ovarian and prostate cancer carcinomas. KLK11 can be activated by thermolysin and is active against a thioester substrate.