Recombinant Human Cathepsin L/CTSL

Instruction Manual!

Product name:	Recombinant Human Cathepsin L/CTSL
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM HAc-NaAc, 150mM NaCl, pH 4.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Cathepsin L is produced by our Mammalian expression system and the target gene encoding Thr18-Val333 is expressed with a 6His tag at the C-terminus.
Names	Cathepsin L1, Major Excreted Protein, MEP, CTSL1, CTSL
Accession #	P07711
Formulation	Supplied as a 0.2 μm filtered solution of 20mM HAc-NaAc, 150mM NaCl, pH 4.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	TLTFDHSLEAQWTKWKAMHNRLYGMNEEGWRRAVWEKNVKMIELHNQEYREGKHSFTMAMNAFGD MTSEEFRQVMNGFQNRKPRKGKVFQEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWAFSATGAL EGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCK YNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHG VLVVGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTVVDHHHHHH
Background	Cathepsin L is an enzyme. Cathepsin L, a lysosomal endopeptidase expressed in most eukaryotic cells, is a member of the papain-like family of cysteine proteinases. Cathepsin L plays a major role in antigen processing, tumor invasion and metastasis, bone resorption, and turnover of intracellular and secreted proteins involved in growth regulation. Unlike the precursor forms of other papain family members, the 43 kDa pro-cathepsin L itself is secreted from various cells. Pro-cathepsin L is the major excreted protein of malignantly transformed mouse fibroblasts and is also one of the major acidic cysteine proteases in mammalian cells.
References	Redundancy between Cysteine Cathepsins in Murine Experimental Autoimmune Encephalomyelitis