Recombinant Human CEACAM1/CD66a

Instruction Manual!

Product name:	Recombinant Human CEACAM1/CD66a
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human CEACAM1 is produced by our Mammalian expression system and the target gene encoding Gln35-Gly428 is expressed with a 6His tag at the C-terminus.
Names	Carcinoembryonic Antigen-Related Cell Adhesion Molecule 1, Biliary Glycoprotein 1, BGP-1, CD66a, CEACAM1, BGP, BGP1
Accession #	P13688
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	QLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQATPGPANSGRE TIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVA FTCEPETQDTTYLWWINNQSLPVSPRLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSANRSDPV TLNVTYGPDTPTISPSDTYYRPGANLSLSCYAASNPPAQYSWLINGTFQQSTQELFIPNITVNNS GSYTCHANNSVTGCNRTTVKTIIVTELSPVVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRW FFKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNVNYNALPQENG LSPGVDHHHHHH
Background	Carcinoembryonic Antigen-Related Cell Adhesion Molecule 1 (CEACAM1) is a member of the Carcinoembryonic Antigen (CEA) family, which belongs to the immunoglobulin superfamily. CEACAM1 is originally described in bile ducts of liver as biliary glycoprotein. Subsequently, it is found to be a cell-cell adhesion molecule detected on leukocytes, epithelia, and endothelia. CEACAM1 mediates cell adhesion via homophilic as well as heterophilic binding to other proteins of the subgroup. In addition, CEACAM1 plays a important role in the differentiation and arrangement of tissue three-dimensional structure, angiogenesis, apoptosis, tumor suppression, metastasis, and the modulation of innate and adaptive immune responses.