Recombinant Human Carboxylesterase 1/CES1

Instruction Manual!

Product name:	Recombinant Human Carboxylesterase 1/CES1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM HAc-NaAc, 150mM NaCl, pH 4.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Carboxylesterase 1 is produced by our Mammalian expression system and the target gene encoding His19-Glu562 is expressed with a 6His tag at the C-terminus.
Names	Liver Carboxylesterase 1, Acyl-Coenzyme A:Cholesterol Acyltransferase, ACAT, Brain Carboxylesterase hBr1, Carboxylesterase 1, CE-1, hCE-1, Cocaine Carboxylesterase, Egasyn, HMSE, Methylumbelliferyl-Acetate Deacetylase 1, Monocyte/Macrophage Serine Esterase, Retinyl Ester Hydrolase, REH, Serine Esterase 1, Triacylglycerol Hydrolase, TGH, CES1, CES2, SES1
Accession #	P23141-3
Formulation	Supplied as a 0.2 μm filtered solution of 20mM HAc-NaAc, 150mM NaCl, pH 4.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	HPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATSY PPMCTQDPKAGQLLSELFTNRKENIPLKLSEDCLYLNIYTPADLTKKNRLPVMVWIHGGGLMVGA ASTYDGLALAAHENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALRWVQDNIASFGGNPG SVTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVALTSVLVKKGDVKPLAEQIAITAGCKTTT SAVMVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAERNFHT VPYMVGINKQEFGWLIPMLMSYPLSEGQLDQKTAMSLLWKSYPLVCIAKELIPEATEKYLGGTDD TVKKKDLFLDLIADVMFGVPSVIVARNHRDAGAPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFS VFGAPFLKEGASEEEIRLSKMVMKFWANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKL KDKEVAFWTNLFAKKAVEKPPQTEVDHHHHHH
Background	Carboxylesterase 1 (CES1) is a member of a large family of carboxylesterases that are responsible for the hydrolysis of ester and amide bonds. These enzymes have broad substrate specificity ranging from small molecule esters such as phenylester to long chain fatty acid esters and thioesters. They are major determinants of the pharmacokinetic behavior of most therapeutic agents containing an ester or amide bond. CES1 shares the serine hydrolase fold observed in other esterases. CES1 hydrolyzes aromatic and aliphatic esters, but has no catalytic activity toward amides or a fatty acyl-CoA ester. CES1 participates in detoxification of drugs such as cocaine and heroin in serum and liver. It may also play a role in detoxification in the lung and/or protection of the central nervous system from ester or amide compounds.
References	Age-Dependent Human Hepatic Carboxylesterase 1 (CES1) and Carboxylesterase 2 (CES2) Postnatal Ontogeny