Recombinant Human CLEC3B/Tetranectin

Instruction Manual!

Product name:	Recombinant Human CLEC3B/Tetranectin
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human CLEC3B is produced by our Mammalian expression system and the target gene encoding Glu22-Val202 is expressed with a 6His tag at the C-terminus.
Names	Tetranectin, TN, C-Type Lectin Domain Family 3 Member B, Plasminogen Kringle 4-Binding Protein, CLEC3B, TNA
Accession #	P05452
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	EPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFT QTKTFHEASEDCISRGGTLSTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGAR IAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIVVDHHHHHH
Background	C-Type Lectin Domain Family 3 Member B (CLEC3B) is a serum and tissue protein and it contais a C-type lectin which binds to Ca++. CLEC3B is originally found in plasma, the concentrations approximately 10mg/l. It can bind to kringle 4 of plasminogen and enhance the activation of plaminogen to plasmin, catalyzed by tissue plasminogen activator in the presence of poly-D-lysine. In addition, CLEC3B may be involved in the packaging of molecules destined for exocytosis. Also, CLEC3B is best known as a prognostic marker in ovarian cancer.