Recombinant Human Fc γ RIIa/FCGR2A/CD32a

Instruction Manual!

Product name:	Recombinant Human Fc γ RIIa/FCGR2A/CD32a
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Fc gamma RIIa is produced by our Mammalian expression system and the target gene encoding Ala36-Ile218 is expressed with a 6His tag at the C-terminus.
Names	Low Affinity Immunoglobulin Gamma Fc Region Receptor II-a, IgG Fc receptor II-a, CDw32, Fc-Gamma RII-a, Fc-Gamma-RIIa, FcRII-a, CD32, FCGR2A, CD32, FCG2, FCGR2A1, IGFR2
Accession #	P12318
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	APPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGE YTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFS RLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVDHHHHHH
Background	Receptors for the Fc region of IgG (FcγR) are members of the Ig superfamily that function in the activation or inhibition of immune responses. Human FcγRs are divided into three classes designated FcγRI (CD64), FcγRII (CD32), and FcγRIII (CD16), which generate multiple isoforms, are recognized. The activating type receptor either has or associates noncovalently with an accessory subunit that has an immunoreceptor tyrosinebased activation motif (ITAM) in its cytoplasmic domain. FcγRI binds IgG with high affinity and functions during early immune responses, whereas FcγRII and RIII are low affinity receptors that recognize IgG as aggregates surrounding multivalent antigens during late immune responses. Three genes for human FcγRII (A, B, and C) and one for mouse (FcγRIIB), encoding type I transmembrane proteins with ITAM motifs (FcγRII A and C) or ITIM motifs (FcγRIIB) in their cytoplasmic domains, have been identified. Human CD32, also known as Low affinity immunoglobulin γ Fc region receptor II-a (IgG Fc receptor II-a), FcγRII A or FCGR2A Protein, is expressed on cells of both myeloid and lymphoid lineages as well as on cells of non-hematopoietic origin. Associated with an ITAM-bearing adapter subunit, FcRγ, CD32a (FcγRII A) delivers an activating signal upon ligand binding, and results in the initiation of inflammatory responses including cytolysis, phagocytosis, degranulation, and cytokine production. The responses can be modulated by signals from the co-expressed inhibitory receptors such as Fcγ RII B, and the strength of the signal is dependent on the ratio of expression of the activating and inhibitory receptors.
References	Kustiawan I,et al.Preventing adsorption of immunoglobulin G to solid surfaces using poloxamer 407 eliminates artifactual stimulation of neutrophils PMID:23545494 http://www.ncbi.nlm.nih.gov/pubmed/23545494