elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human AGER/RAGE

Recombinant Human AGER/RAGE Recombinant Human AGER/RAGE

Instruction Manual!

Product name: Recombinant Human AGER/RAGE
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human AGER is produced by our Mammalian expression system and the target gene encoding Ala23-Ala344 is expressed with a 6His tag at the C-terminus.
Names Advanced Glycosylation End Product-Specific Receptor, Receptor for Advanced Glycosylation End Products, AGER, RAGE
Accession # Q15109
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLP AVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPA GTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRH RALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPP SPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALAVDH HHHHH
Background Advanced Glycosylation End Product-Specific Receptor (AGER) belongs to the immunoglobulin superfamily of cell surface molecules. It lies within the major histocompatibility complex (MHC) class III region on chromosome 6. Besides AGEs, AGER is also able to bind other ligands which is thought to result in pro-inflammatory gene activation. It is known that AGER serve as a mediator of both acute and chronic vascular inflammation in certain conditions such as atherosclerosis and in particular as a complication of diabetes. Furthermore, it plays an important role in regulating the production/expression of TNF-alpha, oxidative stress, and endothelial dysfunction in type 2 diabetes.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese