Recombinant Human Fetuin-B/FETUB

Instruction Manual!

Product name:	Recombinant Human Fetuin-B/FETUB
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Fetuin B is produced by our Mammalian expression system and the target gene encoding Cys16-Pro382 is expressed with a 6His tag at the C-terminus.
Names	Fetuin-B, 16G2, Fetuin-Like Protein IRL685, Gugu, FETUB
Accession #	Q9UGM5
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	CGAMSPPQLALNPSALLSRGCNDSDVLAVAGFALRDINKDRKDGYVLRLNRVNDAQEYRRGGLGS LFYLTLDVLETDCHVLRKKAWQDCGMRIFFESVYGQCKAIFYMNNPSRVLYLAAYNCTLRPVSKK KIYMTCPDCPSSIPTDSSNHQVLEAATESLAKYNNENTSKQYSLFKVTRASSQWVVGPSYFVEYL IKESPCTKSQASSCSLQSSDSVPVGLCKGSLTRTHWEKFVSVTCDFFESQAPATGSENSAVNQKP TNLPKVEESQQKNTPPTDSPSKAGPRGSVQYLPDLDDKNSQEKGPQEAFPVHLDLTTNPQGETLD ISFLFLEPMEEKLVVLPFPKEKARTAECPGPAQNASPLVLPPVDHHHHHH
Background	Fetuin-B is a member of the Fetuin family that is part of the Cystatin superfamily of Cysteine Protease inhibitors. It is reported that Fetuin-B is highly expressed in liver tissue, in tongue and placenta tissues. Fetuin-B is a paralogue of Fetuin-A. Fetuin-A and Fetuin-B display similarities and differences in their characteristics, however, they share only 20% amino acid sequence identity. The amounts of Fetuin-B in human serum, unlike Fetuin-A, vary with gender and are higher in females than in males. Fetuin-B is an inhibitor of basic calcium phosphate precipitation but is less active than Fetuin-A. Fetuin-B expression is decreased in Fetuin-A deficient knock-out mice. The expression of Fetuin-B has been shown to be regulated by FXR (Farnesoid X Receptor), a nuclear receptor activated by bile acids. Evidence has shown that overexpression of Fetuin-B in skin squamous carcinoma cells suppresses tumor growth in nude mice. The function of Fetuin B is still not fully characterized.