Recombinant Human Granzyme A/GZMA

Instruction Manual!

Product name:	Recombinant Human Granzyme A/GZMA
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, pH 5.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Granzyme A is produced by our Mammalian expression system and the target gene encoding Glu27-Val262 is expressed with a 6His tag at the C-terminus.
Names	Granzyme A, CTL Tryptase, Cytotoxic T-Lymphocyte Proteinase 1, Fragmentin-1, Granzyme-1, Hanukkah Factor, H Factor, HF, GZMA, CTLA3, HFSP
Accession #	P12544
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, pH 5.5.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	EKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPT KQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRT HNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGV FRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAVVDHHHHHH
Background	Granzyme A is a member of the Franzyme family. Granzyme A is the most abundant Serine Protease in Cytotoxic T Lymphocytes (CTL) and Natural Killer (NK) cells. Granzyme A has a specifically function in CTL and NK cells. It induces caspase-independent cell death when introduced into target cells by perforin. Human Granzyme A is synthesized as a precursor (262 residues) with a signal peptide (residues 1-26), a propeptide (residues 27-28) and a mature chain (residues 29-262).