Recombinant Human Granzyme A/GZMA
| Product name: | Recombinant Human Granzyme A/GZMA |
| Source: | Human Cells |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, pH 5.5. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | Human Cells |
| Description | Recombinant Human Granzyme A is produced by our Mammalian expression system and the target gene encoding Glu27-Val262 is expressed with a 6His tag at the C-terminus. |
| Names | Granzyme A, CTL Tryptase, Cytotoxic T-Lymphocyte Proteinase 1, Fragmentin-1, Granzyme-1, Hanukkah Factor, H Factor, HF, GZMA, CTLA3, HFSP |
| Accession # | P12544 |
| Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, pH 5.5. |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
EKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPT KQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRT HNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGV FRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAVVDHHHHHH
|
| Background | Granzyme A is a member of the Franzyme family. Granzyme A is the most abundant Serine Protease in Cytotoxic T Lymphocytes (CTL) and Natural Killer (NK) cells. Granzyme A has a specifically function in CTL and NK cells. It induces caspase-independent cell death when introduced into target cells by perforin. Human Granzyme A is synthesized as a precursor (262 residues) with a signal peptide (residues 1-26), a propeptide (residues 27-28) and a mature chain (residues 29-262). |












