Recombinant Human T Cell Immunoglobulin and Mucin Domain-3/TIM3/HAVCR2

Instruction Manual!

Product name:	Recombinant Human T Cell Immunoglobulin and Mucin Domain-3/TIM3/HAVCR2
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human TIM-3 is produced by our Mammalian expression system and the target gene encoding Ser22-Arg200 is expressed with a 6His tag at the C-terminus.
Names	Hepatitis A Virus Cellular Receptor 2, HAVcr-2, T-Cell Immunoglobulin and Mucin Domain-Containing Protein 3, TIMD-3, T-Cell Membrane Protein 3, TIM-3, HAVCR2, TIM3, TIMD3
Accession #	Q8TDQ0
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	SEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNG DFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPAKVTPAPTLQRDFTAAFPRM LTTRGHGPAETQTLGSLPDINLTQISTLANELRDSRLANDLRDSGATIRVDHHHHHH
Background	T-Cell Membrane Protein 3 (TIM3) is a single-pass type I membrane protein that belongs to the TIM family of immunoglobulin superfamily. TIM3 includes a signal sequence (aa 1-21), an extracellular region (aa 22-202) with one Ig-like V-type domain, a transmembrane segment (aa 203-223), and a cytoplasmic domain (aa 224 - 301). TIM3 regulates macrophage activation, inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses and promotes immunological tolerance. It may be also involved in T-cell homing and as a receptor for LGALS9.