Recombinant Human Coxsackievirus and Adenovirus Receptor/CAR/CXADR

Instruction Manual!

Product name:	Recombinant Human Coxsackievirus and Adenovirus Receptor/CAR/CXADR
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Coxsackievirus and Adenovirus Receptor is produced by our Mammalian expression system and the target gene encoding Leu20-Gly237 is expressed with a 6His tag at the C-terminus.
Names	Coxsackievirus and Adenovirus Receptor, CAR, hCAR, CVB3-Binding Protein, Coxsackievirus B-Adenovirus Receptor, HCVADR, CXADR, CAR
Accession #	P78310
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	LSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYY PDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVD GSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTV RNRVGSDQCLLRLNVVPPSNKAGVDHHHHHH
Background	Coxsackievirus and Adenovirus Receptor (CAR) belongs to the CTX family of the Ig superfamily. CXADR is a type I transmembrane glycoprotein and expressed in pancreas, brain, heart, small intestine, testis, prostate. It is a receptor that mediates gene transfer and also act as an adhesion molecule within junctional complexes, notably between epithelial cells lining body cavities and within myocardial intercalated discs. CXADR contains an extracellular domain, a transmembrane helix and a C-terminal intracellular domain. The C-terminal interacts with few cytoplasmic junctional proteins, microtubules and the actin cytoskeleton.