Recombinant Human Cystatin S/CST4

Instruction Manual!

Product name:	Recombinant Human Cystatin S/CST4
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, pH 5.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Cystatin S is produced by our Mammalian expression system and the target gene encoding Ser21-Ala141 is expressed with a 6His tag at the C-terminus.
Names	Cystatin-S, Cystatin-4, Cystatin-SA-III, Salivary Acidic Protein 1, CST4
Accession #	P01036
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, pH 5.5.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	SSSKEENRIIPGGIYDADLNDEWVQRALHFAISEYNKATEDEYYRRPLQVLRAREQTFGGVNYFF DVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWEDRMSLVNSRCQEAVDHHHHHH
Background	Cystatin-S, also called Cystatin-SA-III or Salivary acidic protein, is usually expressed in submandibular and sublingual saliva but not in parotid saliva(at protein level). This protein, which is phosphorylated at both its N- and C-terminal regions, belongs to the cystatin family. Cystatin-S can function as an inhibitor to papain or ficin, it partially inhibits stem bromelain and bovine cathepsin C.