elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Cystatin SA/CST2

Recombinant Human Cystatin SA/CST2 Recombinant Human Cystatin SA/CST2

Instruction Manual!

Product name: Recombinant Human Cystatin SA/CST2
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human Cystatin SA is produced by our Mammalian expression system and the target gene encoding Trp21-Ala141 is expressed with a 6His tag at the C-terminus.
Names Cystatin-SA, Cystatin-2, Cystatin-S5, CST2
Accession # P09228
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
WSPQEEDRIIEGGIYDADLNDERVQRALHFVISEYNKATEDEYYRRLLRVLRAREQIVGGVNYFF DIEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFQIYEVPWEDRMSLVNSRCQEAVDHHHHHH
Background Cystatin SA is a member of family 2 of the Cystatin superfamily. Together with Cystatins S and SN, it is produced by the salivary gland and secreted largely in the submandibular/sublingual saliva. Cystatin SA inhibits Cathepsin L, but may not inhibit Cathepsins B and H. The functions of Cystatin SA are largely unknown. However, it has been suggested to play a role in the control of periodontal tissue destruction.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese