Recombinant Human Cysteine-Rich Secretory Protein 3/CRISP-3/SGP28
| Product name: | Recombinant Human Cysteine-Rich Secretory Protein 3/CRISP-3/SGP28 |
| Source: | Human Cells |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | Human Cells |
| Description | Recombinant Human CRISP-3 is produced by our Mammalian expression system and the target gene encoding Asn21-Tyr245 is expressed with a 6His tag at the C-terminus. |
| Names | Cysteine-Rich Secretory Protein 3, CRISP-3, Specific Granule Protein of 28 kDa, SGP28, CRISP3 |
| Accession # | P54108 |
| Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
NEDKDPAFTALLTTQTQVQREIVNKHNELRRAVSPPARNMLKMEWNKEAAANAQKWANQCNYRHS NPKDRMTSLKCGENLYMSSASSSWSQAIQSWFDEYNDFDFGVGPKTPNAVVGHYTQVVWYSSYLV GCGNAYCPNQKVLKYYYVCQYCPAGNWANRLYVPYEQGAPCASCPDNCDDGLCTNGCKYEDLYSN CKSLKLTLTCKHQLVRDSCKASCNCSNSIYVDHHHHHH
|
| Background | Cysteine-rich secretory protein 3 (CRISP-3) is a secreted protein,containing 1 SCP domain and 1 ShKT domain.It is belongs to the CRISP family. CRISP-3 is a glycoprotein that belongs to the family of cysteine-rich secretory proteins (CRISPs) which was originally discovered in human neutrophilic granulocytes. CRISP-3 is also widely distibuted in exocrine glands (salivary glands, pancreas and prostate), eosinophilic granulocytes and to a lower level in epididymis, ovary, thymus and colon. The presence of CRISP-3 in neutrophils, eosinophils and in exocrine secretions indicates a role in innate host defense. The antibody has been raised against recombinant C-terminally truncated form of CRISP-3 and recognizes both the N-glycosylated and non-glycosylated form of the mature protein. |












