Recombinant Human C-C Motif Chemokine 23/CCL23

Instruction Manual!

Product name:	Recombinant Human C-C Motif Chemokine 23/CCL23
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 250mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human C-C Motif Chemokine 23 is produced by our E.coli expression system and the target gene encoding Arg22-Asn120 is expressed.
Names	C-C Motif Chemokine 23, CK-Beta-8, CKB-8, Macrophage Inflammatory Protein 3, MIP-3, Myeloid Progenitor Inhibitory Factor 1, MPIF-1, Small-Inducible Cytokine A23, CCL23, MIP3, MPIF1, SCYA23
Accession #	P55773
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 250mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MRVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTPRSIPCSLLESYFETNSECSKPGVIF LTKKGRRFCANPSDKQVQVCVRMLKLDTRIKTRKN
Background	Human Chemokine (C-C Motif) Ligand 23 (CCL23) is a small cytokine belonging to the CC chemokine family. CCL23 is also known as myeloid progenitor inhibitory factor MPIF-1, CK8 and SCYA23. CCL23 cDNA encodes a 120 amino acid residue precursor protein with a putative 21 amino acid residue signal peptide that is cleaved to generate a 99 amino acid residue mature CCL23 (amino acids 22 -120). Additional N-terminal Processing of the 99 amino acid residue variant can generate a 75 amino acid residue peptide (amino acid 46-120) that is significantly more active than the 99 amino acid residue variant. CCL23 binds to CCR1 with high affinity and has chemotactic activity for monocytes, dendritic cells, and osteoclast precursors. CCL23 enhances angiogenesis of endothelial cells, but reduces the proliferation of progenitor cells giving rise to granulocyte and monocyte lineages.