Recombinant Human C-X-C Motif Chemokine 14/CXCL14

Instruction Manual!

Product name:	Recombinant Human C-X-C Motif Chemokine 14/CXCL14
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 1M NaCl, pH 8.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human C-X-C Motif Chemokine 14 is produced by our E.coli expression system and the target gene encoding Ser35-Glu111 is expressed.
Names	C-X-C Motif Chemokine 14, Chemokine BRAKm MIP-2G, Small-Inducible Cytokine B14, CXCL14, MIP2G, NJAC, SCYB14
Accession #	O95715
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 1M NaCl, pH 8.5.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Biological Activity	ED50 is 1.0-10.0 ng/ml.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWY NAWNEKRRVYEE
Background	Human Chemokine (C-X-C Motif) Ligand 14 (CXCL14) is constitutively expressed in certain normal tissues but is reduced or absent from many established tumor cell lines and human cancers. CXCL14 is known to be a chemoattractant for monocyte and dendritic cells. CXCL14 inhibits angiogenesis and exhibits antimicrobial activities. Mature human and mouse CXCL14 differ by only 2 amino acid residues.