Recombinant Human Granulocyte Colony-Stimulating Factor/G-CSF

Instruction Manual!

Product name:	Recombinant Human Granulocyte Colony-Stimulating Factor/G-CSF
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 10mM HAc-NaAc, 150mM NaCl, 0.004% Tween 80, 5% Mannitol, pH 4.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Granulocyte Colony-Stimulating Factor is produced by our E.coli expression system and the target gene encoding Thr31-Pro204 is expressed.
Names	Granulocyte Colony-Stimulating Factor, G-CSF, Pluripoietin, Filgrastim, Lenograstim, CSF3, C17orf33, GCSF
Accession #	P09919-2
Formulation	Lyophilized from a 0.2 μm filtered solution of 10mM HAc-NaAc, 150mM NaCl, 0.004% Tween 80, 5% Mannitol, pH 4.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Biological Activity	ED50 is less than 0.1 ng/ml. Specific Activity of 6.0 x 10^7 IU/ mg, measured by the dose-dependent proliferation of murine NFS-60 indicator cells.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSC PSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPA LQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Background	Human Granulocyte-Colony-Stimulating Factor (G-CSF) is 20 kD glycoprotein containing internal disulfide bonds. It induces the survival, proliferation, and differentiation of neutrophilic granulocyte precursor cells and it functionally activates mature blood neutrophils. Among the family of colony-stimulating factors, G-CSF is the most potent inducer of terminal differentiation to granulocytes and macrophages of leukemic myeloid cell lines. The synthesis of G-CSF can be induced by bacterial endotoxins, TNF, Interleukin-1, and GM-CSF. Prostaglandin E2 inhibits the synthesis of G-CSF. In epithelial, endothelial, and fibroblastic cells secretion of G-CSF is induced by Interleukin-17.