Recombinant Mouse V-Set and Ig Domain-Containing Protein 8/VSIG8

Instruction Manual!

Product name:	Recombinant Mouse V-Set and Ig Domain-Containing Protein 8/VSIG8
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of PBS, pH7.4, 10% Glycerol.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse V-set and Immunoglobulin Domain-containing Protein 8 is produced by our Mammalian expression system and the target gene encoding Val22-Gly262 is expressed with a 6His tag at the C-terminus.
Names	V-set and immunoglobulin domain-containing protein 8; Vsig8
Accession #	Q6P3A4
Formulation	Supplied as a 0.2 μm filtered solution of PBS, pH7.4, 10% Glycerol.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	VRINGDGQEVMYLAEGDNVRLGCPYLLDPEDLGTNSLDIEWMQVNSEPSHRENVFLTYQDKRIGH GNLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCW TEGHMSKGNDVVLKCFANGGSQPLSYKWAKISGHSHPYRAGAYHSQHSFHSELSYQESFHSTINQ GLGNGDLLLKGINADDDGLYQCTVANHVGYSVCVVEVKVSDSQRVGHHHHHH
Background	V-set and immunoglobulin domain-containing protein 8(VSIG8) is a single-pass type I membrane protein.The mouse VSIG8 cDNA encodes 417 amino acids (aa) including a 21 aa signal sequence, a 241 aa extracellular domain (ECD) containing 2 Ig-like V-type (immunoglobulin-like) domains, a 21 aa transmembrane domain and a 134 aa cytoplasmic domain. The function of VSIG8 is not clear.