Recombinant Mouse Carbonic Anhydrase 4/CAIV/CA4

Instruction Manual!

Product name:	Recombinant Mouse Carbonic Anhydrase 4/CAIV/CA4
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse Carbonic anhydrase 4 is produced by our expression system and the target gene encoding Glu18-Ser277 is expressed
Names	CA4;CAIV;CA-IV;Car4;Carbonate dehydratase IV;carbonic anhydrase 4;carbonic anhydrase IVRP17;carbonic dehydratase IV;EC4.2.1.1;retinitis pigmentosa 17;RP17
Accession #	Q64444
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	EDSGWCYEIQTKDPRSSCLGPEKWPGACKENQQSPINIVTARTKVNPRLTPFILVGYDQKQQWPI KNNQHTVEMTLGGGACIIGGDLPARYEAVQLHLHWSNGNDNGSEHSIDGRHFAMEMHIVHKKLTS SKEDSKDKFAVLAFMIEVGDKVNKGFQPLVEALPSISKPHSTSTVRESSLQDMLPPSTKMYTYFR YNGSLTTPNCDETVIWTVYKQPIKIHKNQFLEFSKNLYYDEDQKLNMKDNVRPLQPLGKRQVFKS
Background	Carbonic anhydrase 4(CA4) is an enzyme that belongs to the alpha-carbonic anhydrase family. CA4 consists of a signal peptide (residues1-17), an ectodomain (residues18-277) and a propeptide (residues278-305), which is removed in the mature form. it is predominantly expressed in the embryo. CA4 can catalyzes the reversible reaction of CO2+H2O=HCO3-+H+, and stimulates the sodium/bicarbonate transporter activity of SLC4A4. Studies have shown that this protein have a role in inherited renal abnormalities of bicarbonate transport. Alpha-carbonic anhydrase family participate in avariety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor. They show extensive diversity in tissue is attribution and in their sub cellular localization.