Recombinant Mouse T-lymphocyte Surface Antigen Ly-9/SLAMF3/CD229

Instruction Manual!

Product name:	Recombinant Mouse T-lymphocyte Surface Antigen Ly-9/SLAMF3/CD229
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse T-lymphocyte surface antigen Ly-9 is produced by our Mammalian expression system and the target gene encoding Lys48-Phe454 is expressed with a 6His tag at the C-terminus.
Names	T-lymphocyte surface antigen Ly-9; Cell surface molecule Ly-9; Lymphocyte antigen 9; SLAM family member 3; SLAMF3; Signaling lymphocytic activation molecule 3; CD229; Ly9; Ly-9
Accession #	Q4VBG4
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	KETPPTVISGMLGGSVTFSLNISKDAEIEHITWNCPPKALALVSYKKDITILDKGYNGRLKVSED GYSLYMSNLTKSDSGSYYAQINQKNVTLTTNKEFTLHIYEKLQKPQIIVESVTPSDTDSCTFTLI CTVKGTKDSVQYSWTREDTHLNTYDGSHTLRVSQSVCDPDLPYTCKAWNPVSQNSSQPVRIWQFC TGASRRKTAAGKTVVGILGEPVTLPLEFRATRATKNVVWVFNTSVISQERRGAATADSRRKPKGS EERRVRTSDQDQSLKISQLKMEDAGPYHAYVCSEASRDPSVRHFTLLVYKRLEKPSVTNSPVHMM NGICKVVLTCSVDGGGNNVTYTWMPLQNKAVMSQGKSHLNVSWESGEHLPNFTCTAHNPVSNSSS QFSSGTICSGPERNKRFHHHHHH
Background	CD229(SLAMF3) is a type I transmembrane glycoprotein in the SLAM subgroup of the CD2 family. Mature mouse CD229 consists of a 406 aa extracellular domain (ECD) with two Ig-like V-set and two Ig-like truncated C2-set domains, a 21 aa transmembrane segment, and a 180 aa cytoplasmic domain with two immunoreceptor tyrosinebased switch motifs ITSMs. Within the first two Ig-like domains that are common to all SLAM proteins, mouse CD229 shares 22%-36% aa sequence identity with mouse 2B4, BLAME, CD2F10,CD84, CRACC, NTBA, and SLAM. CD229 is expressed on T, B, and NK cells, thymocytes and monocytes. Homophilic binding between CD229 molecules is mediated by the N-terminal Ig-like domain. Human and mouse CD229 exhibit crossspecies binding. Antigen stimulation of lymphocytes induces CD229 clustering to sites of T cell-B cell contact. Antibody ligation of CD229 can inhibit T cell activation, but CD229 knockout mice show impaired T cell immune responses, suggesting a potential role for CD229 in T cell activation or costimulation.