Recombinant Mouse C-C motif Chemokine 8/CCL8/MCP-2

Instruction Manual!

Product name:	Recombinant Mouse C-C motif Chemokine 8/CCL8/MCP-2
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse C-C motif Chemokine 8 is produced by our expression system and the target gene encoding Glu20-Pro97 is expressed
Names	C-C motif chemokine 8;Ccl8;Monocyte chemoattractant protein 2;Monocyte chemotactic protein 2;MCP-2;Small-inducible cytokine A8;Mcp2; Scya8
Accession #	Q9Z121
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH3O. Please aliquot the reconstituted solution toࣈࣈࣈࣈࣈࣈ
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	EKLTGPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEY MEILDQKSQILQPHHHHHH
Background	Chemokine ligand 8 (CCL8,MCP-2), is a small secreted cytokine which belongs to the intercrine beta (chemokine CC) family. CCL8 Chemotactic factor attracts monocytes. It can bind heparin.CCL8 functions to activate different immune cells, including mast cells, eosinophils and basophils which are involved in allergic responses, monocytes, and T cells and NK cells which are involved in the inflammatory response. Its ability achieves by binding to different cell surface receptors termed chemokine receptors including CCR1, CCR2B and CCR5. It has been reported that CCL8 is a potent inhibitor of HIV-1 by virtue of its binding to CCR5 which is one of the major co-receptors for HIV-1.