Recombinant Mouse Thrombomodulin/BDCA-3/CD141

Instruction Manual!

Product name:	Recombinant Mouse Thrombomodulin/BDCA-3/CD141
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse Thrombomodulin is produced by our Mammalian expression system and the target gene encoding Leu17-Ser517 is expressed with a 6His tag at the C-terminus.
Names	Thrombomodulin; TM; Fetomodulin; CD141; BDCA-3; Thbd
Accession #	P15306
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	LSALAKLQPTGSQCVEHECFALFQGPATFLDASQACQRLQGHLMTVRSSVAADVISLLLSQSSMD LGPWIGLQLPQGCDDPVHLGPLRGFQWVTGDNHTSYSRWARPNDQTAPLCGPLCVTVSTATEAAP GEPAWEEKPCETETQGFLCEFYFTASCRPLTVNTRDPEAAHISSTYNTPFGVSGADFQTLPVGSS AAVEPLGLELVCRAPPGTSEGHWAWEATGAWNCSVENGGCEYLCNRSTNEPRCLCPRDMDLQADG RSCARPVVQSCNELCEHFCVSNAEVPGSYSCMCETGYQLAADGHRCEDVDDCKQGPNPCPQLCVN TKGGFECFCYDGYELVDGECVELLDPCFGSNCEFQCQPVSPTDYRCICAPGFAPKPDEPHKCEMF CNETSCPADCDPNSPTVCECPEGFILDEGSVCTDIDECSQGECFTSECRNFPGSYECICGPDTAL AGQISKDCDPIPVREDTKEEEGSGEPPVSPTPGSPTGPPSARPVHSHHHHHH
Background	Thrombomodulin is also known as CD141 antigen and blood dendritic cell antigen 3 (BDCA3), which is encoded by the THBD gene. The deduced amino acid sequence of mouse THBD predicts a signal peptide (aa 1 to 16) and a mature chain (aa 17 to 577) that consists of the following domains: C-type lectin, EGF-like, transmembrane and cytoplasmic. Mouse THBD is corresponding to the extracellular portion of the type I membrane protein. Predominantly synthesized by vascular endothelial cells, THBD inhibits coagulation and fibrinolysis. It functions as a cell surface receptor and an essential cofactor for active thrombin, which in turn activates protein C and thrombinactivatable fibrinolysis inhibitor (TAFI), also known as carboxypeptidase B2 (CPB2). In addition, THBD gene polymorphisims are associated with human disease and THBD plays a role in thrombosis, stroke, arteriosclerosis, and cancer.