Recombinant Mouse ADP-ribosyl Cyclase/cyclic ADP-ribose Hydrolase 2/CD157

Instruction Manual!

Product name:	Recombinant Mouse ADP-ribosyl Cyclase/cyclic ADP-ribose Hydrolase 2/CD157
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse ADP-ribosyl Cyclase/cyclic ADP-ribose Hydrolase 2 is produced by our Mammalian expression system and the target gene encoding Ala25-Glu285 is expressed with a 6His tag at the C-terminus.
Names	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2; ADP-ribosyl cyclase 2; Antigen BP3; BP-3 alloantigen; Bone marrow stromal antigen 1; BST-1; Cyclic ADP-ribose hydrolase 2; cADPr hydrolase 2; Leukocyte antigen 65; Ly-65; CD157; Bst1; Bp-3; Bp3; Ly65
Accession #	Q64277
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	ARARWRGEGTTPHLQSIFLGRCAEYTTLLSLGNKNCTAIWEAFKGVLDKDPCSVLPSDYDLFINL SRHPIPRDKSLFWENNHLLVMSYGENTRRLVALCDVLYGKVGDFLSWCRQENASGLDYQSCPTSE DCENNAVDSYWKSASMQYSRDSSGVINVMLNGSEPKGAYPTRGFFADFEIPYLQKDKVTRIEIWV MHDVGGPNVESCGEGSVKILEDRLEALGFQHSCINDYRPVKFLMCVDHSTHPDCIMNSASASMRR EHHHHHH
Background	CD157 is a glycosyl phosphatidylinositol anchored membrane protein that belongs to the CD38 family. CD157 was discovered in a bone marrow stromal cell line where it facilitates preBcell growth. Along with CD38, CD157 is a bifunctional ectoenzyme that exhibits both ADP-ribosyl cyclase and cyclic ADP ribose hydrolase activities. It may play a role in rheumatoid arthritis (RA) due to its enhanced expression in RA-derived bone marrow stromal cell lines. CD157 has been predicted to function as a cell surface receptor and an immunoregulatory molecule. CD157 was originally identified as a bone marrow stromal cell molecule (BST-1) with a glycosylphosphatidylinositol (GPI) anchor to bind to the cell surface. CD157 is prevalently expressed by cells of the myeloid lineage. CD157 could act as a receptor with signal transduction capability. Further, it regulates calcium homeostasis and promotes polarization in neutrophils and mediates superoxide (O2−) production in the human U937 myeloid line.