Recombinant Mouse/Rat Bone Morphogenetic Protein 7

Instruction Manual!

Product name:	Recombinant Mouse/Rat Bone Morphogenetic Protein 7
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 4mM HCl.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse/Rat Bone Morphogenetic Protein 7 is produced by our Mammalian expression system and the target gene encoding Ser292-His430 is expressed.
Names	Bone morphogenetic protein 7; BMP-7; Osteogenic protein 1; OP-1; Bmp7
Accession #	P23359
Formulation	Lyophilized from a 0.2 μm filtered solution of 4mM HCl.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	STGGKQRSQNRSKTPKNQEALRMASVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAY YCEGECAFPLNSYMNATNHAIVQTLVHFINPDTVPKPCCAPTQLNAISVLYFDDSSNVILKKYRN MVVRACGCH
Background	Bone morphogenetic protein 7 (BMP-7) is a widely expressed TGF-β superfamily member with important functions during embryogenesis, in the adult, and in disease. The growth factor domain of mouse BMP-7 shares 98% and 100% aa sequence identity with human and rat BMP-7, respectively. The BMP-7 propeptide is cleaved intracellularly but remains in association with the growth factor domain. BMP-7 is subsequently secreted as a tetramer that consists of two propeptides and two disulfide-linked growth factor domains. Mature BMP-7 can also form disulfide-linked heterodimers with BMP-2 or BMP-4, complexes that show increased potency and range of activity compared to BMP-7 homodimers. BMP-7 exerts its biological effects through the type 2 receptors Activin RIIA, Activin RIIB, and BMPR-II and the type 1 receptors Activin RIA, BMPR-IA, and BMPR-IB. BMP-7 plays a role in a variety of organ systems. It promotes new bone formation and nephron development, inhibits the branching of prostate epithelium, and antagonizes epithelial-mesenchymal transition (EMT). In pathological conditions, BMP-7 inhibits tumor growth and metastasis, ameliorates fibrotic damage in nephritis, and promotes neuroregeneration following brain ischemia.