Recombinant Mouse Leucine-rich Repeats and IG-like Domains Protein 1/LRIG1

Instruction Manual!

Product name:	Recombinant Mouse Leucine-rich Repeats and IG-like Domains Protein 1/LRIG1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse Leucine-rich Repeats and Immunoglobulin-like Domains Protein 1 is produced by our Mammalian expression system and the target gene encoding Ala35-Thr794 is expressed with a 6His tag at the C-terminus.
Names	Leucine-rich repeats and immunoglobulin-like domains protein 1; LIG-1; Lrig1
Accession #	P70193
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	AQAGPRAPCAAACTCAGDSLDCSGRGLATLPRDLPSWTRSLNLSYNRLSEIDSAAFEDLTNLQEV YLNSNELTAIPSLGAASIGVVSLFLQHNKILSVDGSQLKSYLSLEVLDLSSNNITEIRSSCFPNG LRIRELNLASNRISILESGAFDGLSRSLLTLRLSKNRITQLPVKAFKLPRLTQLDLNRNRIRLIE GLTFQGLDSLEVLRLQRNNISRLTDGAFWGLSKMHVLHLEYNSLVEVNSGSLYGLTALHQLHLSN NSISRIQRDGWSFCQKLHELILSFNNLTRLDEESLAELSSLSILRLSHNAISHIAEGAFKGLKSL RVLDLDHNEISGTIEDTSGAFTGLDNLSKLTLFGNKIKSVAKRAFSGLESLEHLNLGENAIRSVQ FDAFAKMKNLKELYISSESFLCDCQLKWLPPWLMGRMLQAFVTATCAHPESLKGQSIFSVLPDSF VCDDFPKPQIITQPETTMAVVGKDIRFTCSAASSSSSPMTFAWKKDNEVLANADMENFAHVRAQD GEVMEYTTILHLRHVTFGHEGRYQCIITNHFGSTYSHKARLTVNVLPSFTKIPHDIAIRTGTTAR LECAATGHPNPQIAWQKDGGTDFPAARERRMHVMPDDDVFFITDVKIDDMGVYSCTAQNSAGSVS ANATLTVLETPSLAVPLEDRVVTVGETVAFQCKATGSPTPRITWLKGGRPLSLTERHHFTPGNQL LVVQNVMIDDAGRYTCEMSNPLGTERAHSQLSILPTPGCRKDGTTHHHHHH
Background	LRIG1 is a leucine-rich repeat (LRR) and Ig-like domain-containing single-pass transmembrane glycoprotein. LRIG1 shares 45-50% aa identity with its mammalian paralogs, LRIG2 and LRIG3. LIRG1 is expressed widely throughout mouse and human tissues, including the liver, brain, stomach, small intestine, skeletal muscle, cornea, and hair follicle. It has been shown to suppress tumor growth, regulate tissue homeostasis, and maintain stem cell quiescence. The LRIG1 ECD contains three C-type Ig-like domains as well as fifteen LRRs that are flanked by cysteine-rich regions. LRIG1 functions as a tumor suppressor by controlling cell proliferation through the negative regulation of the EGF family of receptor tyrosine kinases. LRIG1 expression, which is often dysregulated in human cancers, is a prognostic indicator of cancer development and relapse; Decreased LRIG1 is associated with an increase in recurrence and mortality for a variety of cancers including breast, uterine, headandneck, glioma, prostate, and squamous cell. Tissue homeostasis and stem cell dormancy is also thought to be modulated by the actions of LRIG1 on cell proliferation.