Recombinant Mouse Alpha-1-antitrypsin 1-1/Serpin A1a

Instruction Manual!

Product name:	Recombinant Mouse Alpha-1-antitrypsin 1-1/Serpin A1a
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse Alpha-1-antitrypsin 1-1 is produced by our Mammalian expression system and the target gene encoding Glu25-Lys413 is expressed with a 6His tag at the C-terminus.
Names	Alpha-1-antitrypsin 1-3;Alpha-1 protease inhibitor 3;Alpha-1 protease inhibitor 6;Alpha-1-antitrypsin 1-6;Serine protease inhibitor 1-3;Serine protease inhibitor 1-6;Serine protease inhibitor A1c;Serpin A1c;Serpina1c;Dom3; Dom6; Spi1-3; Spi1-6
Accession #	P07758
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	EDVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGD THTQILEGLQFNLTQTSEADIHNSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKN HYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIVEAVKKLEQDTVFVLANYILFKGKWKKPFDPE NTKQAEFHVDESTTVKVPMMTLSGMLDVHHCSTLSSWVLLMDYAGNATAVFLLPDDGKMQHLEQT LNKELISKFLLNRRRRLAQIHIPRLSISGNYNLETLMSPLGITRIFNSGADLSGITEENAPLKLS QAVHKAVLTIDETGTEAAAATVLQGGFLSMPPILHFNRPFLFIIFEEHSQSPLFVGKVVDPTHKV DHHHHHH
Background	Alpha-1-antitrypsin 1-3(SERPIN A1) is a secreted protein and belongs to the serpin family. Serpins bind the protease active site resulting in a major conformational rearrangement that traps the enzyme in a covalent acyl-enzyme intermediate. Mouse SERPIN A1 is a serine protease inhibitor whose targets include elastase,plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. Defects in this gene can cause emphysema orliver disease. Several transcript variants encoding the same protein have been found for this gene.