Recombinant Mouse ST6GALNAC2

Instruction Manual!

Product name:	Recombinant Mouse ST6GALNAC2
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 50mMTris,150mMNaCl,pH7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse Alpha-N-acetylgalactosaminide Alpha-2,6-sialyltransferase 2 is produced by our Mammalian expression system and the target gene encoding Ser28-Arg373 is expressed with a 6His tag at the C-terminus.
Names	Gal-beta-1,3-GalNAc alpha-2,6-sialyltransferase,GalNAc alpha-2,6-sialyltransferase II,ST6GalNAc II,Sialyltransferase 7B,SIAT7-B
Accession #	P70277
Formulation	Supplied as a 0.2 μm filtered solution of 50mMTris,150mMNaCl,pH7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	SAGQQSPETQVPARNMAYPRAFFDPKPPNSENRKSRLCQHSLSLAIQKDRRFRSLFDLSTPVLLW EGLFTQELWNNLSQHKVPYGWQGLSHEVIASTLRLLKSPESGELFGAPRKLPLSCIRCAVVGNGG ILNGSRQGQKIDAHDYVFRLNGAITEAFERDVGTKTSFYGFTVNTMKNSLISYAKLGFTSVPQGQ NLRYIFIPSSIRDYLMLRSAILGVPVPEGPDKGDRPHTYFGPETSASKFKLLHPDFISYLTERFL KSKLINTRFGDMYMPSTGALMLLTALHTCDQVSAYGFITNNYQKYSDHYFEREKKPLIFYANHDL SLEASLWRDLHNAGILWLYQRVDHHHHHH
Background	Alpha‑N‑acetylgalactosaminide alpha ‑2,6‑sialyltransferase 2, is a type II membrane protein localized in the Golgi network and catalyzes 2,6‑sialylation of the Tn antigen. Sialyl‑Tn antigen is highly expressed in several human carcinomas and is associated with carcinoma aggressiveness and poor prognosis. it has been reported that disregulation of this gene is involved in the pathogenesis of IgA nephropathy, a common kidney disease that occurs when antibody IgA accumulates in kidneys (4). The enzyme may also be used to synthesize a cancer vaccine.