Recombinant Mouse Pulmonary Surfactant-associated Protein D/SP-D

Instruction Manual!

Product name:	Recombinant Mouse Pulmonary Surfactant-associated Protein D/SP-D
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse Pulmonary Surfactant-associated Protein D is produced by our Mammalian expression system and the target gene encoding Ala20-Phe374 is expressed with a 6His tag at the C-terminus.
Names	COLEC7collectin-7; Collectin 7; Lung surfactant protein D; PSPD; SFTP4; SFTP4pulmonary surfactant-associated protein D; SFTPD; SPD; SP-D; SP-Dpulmonary surfactant apoprotein; surfactant protein D; surfactant, pulmonary-associated protein D; surfactant-associated protein, pulmonary 4
Accession #	P50404
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	AEMKSLSQRSVPNTCTLVMCSPTENGLPGRDGRDGREGPRGEKGDPGLPGPMGLSGLQGPTGPVG PKGENGSAGEPGPKGERGLSGPPGLPGIPGPAGKEGPSGKQGNIGPQGKPGPKGEAGPKGEVGAP GMQGSTGAKGSTGPKGERGAPGVQGAPGNAGAAGPAGPAGPQGAPGSRGPPGLKGDRGVPGDRGI KGESGLPDSAALRQQMEALKGKLQRLEVAFSHYQKAALFPDGRSVGDKIFRTADSEKPFEDAQEM CKQAGGQLASPRSATENAAIQQLITAHNKAAFLSMTDVGTEGKFTYPTGEPLVYSNWAPGEPNNN GGAENCVEIFTNGQWNDKACGEQRLVICEFVDHHHHHH
Background	SP‑D (surfactant protein‑D) is a 43 kDa member of the collectin family of innate immune modulators. Mouse SP‑D cDNA encodes a 19 aa signal sequence and a 355 aa mature region with a 25 aa N‑terminal linking‑region, a 177 aa hydroxyproline and hydroxylysine collagen‑like domain, a 46 aa coiled‑coil segment, and a 106 aa, C‑terminal collectin‑like C‑type lectin domain .SP‑D is usually found as a glycosylated, disulfide‑linked 150 kDa alpha ‑helical coiled‑coil trimer with a “head” of three symmetrical CRDs . SP‑D also binds SIRP alpha and the calreticulin/CD91 complex on macrophages.