Recombinant Mouse Bone Sialoprotein 2/IBSP

Instruction Manual!

Product name:	Recombinant Mouse Bone Sialoprotein 2/IBSP
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse Bone Sialoprotein 2 is produced by our Mammalian expression system and the target gene encoding Phe17-Gln324 is expressed with a 6His tag at the C-terminus.
Names	BNSP; Bone sialoprotein 2; Bone sialoprotein; BSP; BSP2; BSPII; Cell binding sialoprotein; IBSP; Integrin binding sialoprotein; SP II;
Accession #	Q61711
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	FSMKNFHRRIKAEDSEENGVFKYRPRYFLYKHAYFYPPLKRFPVQGGSDSSEENGDGDSSEEEGE EEETSNEEENNEDSEGNEDQEAEAENATLSTLSGVTASYGAETTPQAQTFELAALQLPKKAGDAE SRAPKVKESDEEEEEEEEEEENENEEAEVDENELAVNGTSTNSTEVDGGNGSSGGDNGEEAEAEE ASVTEAGAEGTTGGRELTSVGTQTAVLLNGFQQTTPPPEAYGTTSPPIRKSSTVEYGGEYEQTGN EYNNEYEVYDNENGEPRGDTYRAYEDEYSYYKGHGYEGYEGQNYYYHQVDHHHHHH
Background	IBSP, is a monomeric non‑collagenous member of the SIBLING family of extracellular matrix proteins. It is principally associated with the early stages of bone mineralization. Mouse IBSP is synthesized as a 324 amino acid (aa) precursor that contains a 16 aa signal sequence and a 308 aa mature region. The mature segment is divided into a basic N‑terminus (aa 17 ‑ 62), a central region (aa 63 ‑ 233), and an acidic C‑terminus (aa 234 ‑ 317). IBSP is highly glycosylated, sulfated and phosphorylated. Phosphorylation promotes HAp nucleation, while carbohydrate may regulate cell adhesion.