Recombinant Mouse Receptor-type tyrosine-protein kinase FLT3/Flt-3

Instruction Manual!

Product name:	Recombinant Mouse Receptor-type tyrosine-protein kinase FLT3/Flt-3
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse Receptor-type tyrosine-protein kinase FLT3 is produced by our Mammalian expression system and the target gene encoding Asn28-Ser544 is expressed with a Fc tag at the C-terminus.
Names	CD135; fetal liver kinase 2; FL cytokine receptor; FLK2; FLT3 receptor tyrosine kinase; Flt3; Fms-like tyrosine kinase 3;
Accession #	Q00342
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	NQDLPVIKCVLISHENNGSSAGKPSSYRMVRGSPEDLQCTPRRQSEGTVYEAATVEVAESGSITL QVQLATPGDLSCLWVFKHSSLGCQPHFDLQNRGIVSMAILNVTETQAGEYLLHIQSEAANYTVLF TVNVRDTQLYVLRRPYFRKMENQDALLCISEGVPEPTVEWVLCSSHRESCKEEGPAVVRKEEKVL HELFGTDIRCCARNALGRECTKLFTIDLNQAPQSTLPQLFLKVGEPLWIRCKAIHVNHGFGLTWE LEDKALEEGSYFEMSTYSTNRTMIRILLAFVSSVGRNDTGYYTCSSSKHPSQSALVTILEKGFIN ATSSQEEYEIDPYEKFCFSVRFKAYPRIRCTWIFSQASFPCEQRGLEDGYSISKFCDHKNKPGEY IFYAENDDAQFTKMFTLNIRKKPQVLANASASQASCSSDGYPLPSWTWKKCSDKSPNCTEEIPEG VWNKKANRKVFGQWVSSSTLNMSEAGKGLLVKCCAYNSMGTSCETIFLNSPGPFPFIQDNISVDD IEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVK FNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Background	The Flt-3 receptor, also named Flk-2 and Stk-1, is a member of the class III subfamily of receptor tyrosine kinases.Mouse Flt-3 cDNA encodes a 992 amino acid (aa) residue type I membrane protein with a 27 aa residue signal peptide, a 517 aa extracellular domain with 10 potential N-linked glycosylation sites, a 20 aa residue transmembrane domain and a 428 aa residue cytoplasmic domain. Flt-3 expression has been detected in various tissues, including placenta, gonads, and tissues of nervous and hematopoietic origin. Among hematopoietic cells, the expression of Flt-3 was found to be restricted to the highly enriched stem/progenitor cell populations. The ligand for Flt-3 (FL) has been identified to be a transmembrane protein with structural homology to M-CSF and SCF.