Recombinant Mouse Interleukin-5 Receptor Subunit Alpha/IL-5 Rα

Instruction Manual!

Product name:	Recombinant Mouse Interleukin-5 Receptor Subunit Alpha/IL-5 Rα
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse Interleukin-5 Receptor Subunit Alpha is produced by our Mammalian expression system and the target gene encoding Asp18-His339 is expressed with a 6His tag at the C-terminus.
Names	Interleukin-5 receptor subunit alpha; IL-5 receptor subunit alpha; IL-5R subunit alpha; IL-5R-alpha; IL-5RA; CD125; Il5ra; Il5r
Accession #	P21183
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	DLLNHKKFLLLPPVNFTIKATGLAQVLLHWDPNPDQEQRHVDLEYHVKINAPQEDEYDTRKTESK CVTPLHEGFAASVRTILKSSHTTLASSWVSAELKAPPGSPGTSVTNLTCTTHTVVSSHTHLRPYQ VSLRCTWLVGKDAPEDTQYFLYYRFGVLTEKCQEYSRDALNRNTACWFPRTFINSKGFEQLAVHI NGSSKRAAIKPFDQLFSPLAIDQVNPPRNVTVEIESNSLYIQWEKPLSAFPDHCFNYELKIYNTK NGHIQKEKLIANKFISKIDDVSTYSIQVRAAVSSPCRMPGRWGEWSQPIYVGKERKSLVEWHHHH HHH
Background	Interleukin 5 Receptor alpha (IL-5 Rα), also known as CD125, is a hematopoietin receptor that plays a dominant role in eosinophil biology. Mature mouse IL-5 Rα consists of a 322 amino acid (aa) extracellular domain (ECD) with a WSxWS motif and a four cysteine motif, a 22 aa transmembrane segment, and a 54 aa cytoplasmic domain. The high affinity receptor for IL-5 is a complex that consists of the ligand binding IL-5 Rα and the transmembrane common β chain (βc/CD131) which is shared with the receptor complexes for IL-3 and GM-CSF. IL-5 Rα binds IL-5 at low affinity and then associates with preformed βc oligomers to form the signaling-competent receptor complex. IL-5 stimulation of CD34+ hematopoietic progenitor cells induces the up-regulation of transmembrane IL-5 Rα followed by eosinophilic differentiation and activation. IL-5 Rα also promotes the differentiation of basophils and B cells. Exposure of mature eosinophils to IL-5 attenuates their IL-5 responsiveness by inducing the down-regulation of surface IL-5 Rα and increased production of soluble IL-5 Rα.