Recombinant Mouse Fc γ RIIIA/FCGR3/CD16

Instruction Manual!

Product name:	Recombinant Mouse Fc γ RIIIA/FCGR3/CD16
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human cells
Description	Recombinant Mouse Fc gamma receptor III is produced by our Mammalian expression system and the target gene encoding Leu32-Thr215 is expressed with a 6His tag at the C-terminus.
Names	Low affinity immunoglobulin gamma Fc region receptor III; Fcgr3; Fc gamma Receptor III; CD-antigen 16; CD16; FcRIII; IgG Fc receptor III
Accession #	Q5D5I8
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	LPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSVRSQVQASYTFKATVNDSGEY RCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHH YKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHTHHHHHH
Background	Low affinity immunoglobulin gamma Fc region receptor III (Fc gamma RIII/CD16) is a member of the Ig superfamily. Based on close relationships in their extracellular domains, the Fc gamma Rs have been divided into three classes composing of Fc gamma RI (CD64), Fc gamma RII (CD32), and Fc gamma RIII (CD16). Each group may be encoded by multiple genes and exist in different isoforms depending on species and cell type. Mouse CD16 is a type I transmembrane protein having two extracellular Ig-like domains consisting of immunoglobulin domain, repeat, signa and transmembrane, transmembrane helix. It is expressed on a variety of myeloid and lymphoid cells and associates with Fc R gamma to deliver an activating signal upon ligand binding. Fcgr3 is IgG binding and activation or inhibition of immune responses such as antibody-dependent cellular cytotoxicity, phagocytosis, cell surface receptor signaling pathway and positive regulation of type I/IIa/III hypersensitivity.