Recombinant Mouse Butyrophilin Subfamily 1 Member A1/BTN1A1

Instruction Manual!

Product name:	Recombinant Mouse Butyrophilin Subfamily 1 Member A1/BTN1A1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse Butyrophilin Subfamily 1 Member A1 is produced by our Mammalian expression system and the target gene encoding Ala27-Trp247 is expressed fused with a 6His tag at the C-terminus.
Names	Butyrophilin subfamily 1 member A1; BTN; BTN1A1;butyrophilin;Btn1a1
Accession #	Q62556
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	AAPFDVTAPQEPVLALVGSDAELTCGFSPNASSEYMELLWFRQTRSTAVLLYRDGQEQEGQQMTE YRGRATLATAGLLDGRATLLIRDVRVSDQGEYRCLFKDNDDFEEAAVYLKVAAVGSDPQISMTVQ ENGEMELECTSSGWYPEPQVQWRTGNREMLPSTSESKKHNEEGLFTVAVSMMIRDSSIKNMSCCI QNILLGQGKEVEISLPAPFVPRLTPWHHHHHH
Background	Mouse Butyrophilin subfamily 1 member A1(BTN1A1) is a type I transmembrane glycoprotein which is a member of the Ig superfamily. The BTN1A1 ECD displays two predicted IgV and IgC domains as do B7 and Skint proteins which interact with other Ig superfamily members. BTN1A1 binds to xanthine oxidoreductase (XOR). This interaction stabilizes the association of XOR with the milk fat globule membrane and appears to be essential in the control of milk fat globule secretion. In vitro, BTN1A1 inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL-2 and IFN-γ secretion. Furthermore, in vivo, BTN1A1 has a protective effect against the development of experimental autoimmune encephalomyelitis (EAE). Because butyrophilins are structurally related to B7 proteins and are functionally implicated in immune regulation, they may represent an emerging family of costimulatory/inhibitory molecules.