Recombinant Mouse Fc Receptor-like Protein 1/FCRL1/FcRH1

Instruction Manual!

Product name:	Recombinant Mouse Fc Receptor-like Protein 1/FCRL1/FcRH1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse Fc receptor-like protein 1 is produced by our expression system and the target gene encoding Ala17-Ser219 is expressed with a 6His tag at the C-terminus.
Names	Fc receptor-like protein 1, FcR-like protein 1, FcRL1, BXMAS1-like protein 1, mBXMH1, Fc receptor homolog 1, FcRH1 , moFcRH1 , IFGP family protein 1, mIFGP1, CD307a
Accession #	Q8R4Y0
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	AGISDVSLKTRPPGGWVMEGDKLVLICSVDRVTGNITYFWYRGALGFQLETKTQPSLTAEFEISD MKQSDADQYYCAANDGHDPIASELVSIHVRVPVSRPVLTFGDSGTQAVLGDLVELHCKALRGSPP IFYQFYHESIILGNSSAPSGGGASFNFSLTAEHSGNFSCEASNGQGAQRSEVVALNLTGLSLVPT ENGISHLSHHHHHH
Background	Mouse Fc receptor-like protein 1 (FCRL1) is a single-pass type I membrane protein. It is expressed in B-cells at the various stages of differentiation. Mouse FCRL1 consists of a 203 amino acid (aa) extracellular domain (ECD) with two Ig‑like domains, a 21 aa transmembrane segment, and a 103 aa cytoplasmic domain with two immunotyrosine activation motifs (ITAMs). FCRL1 is likely not a receptor for immunoglobulin. It may function as an activating coreceptor in B-cells and B-cells differentiation.