Recombinant Mouse Platelet Receptor Gi24/VISTA/B7-H5

Instruction Manual!

Product name:	Recombinant Mouse Platelet Receptor Gi24/VISTA/B7-H5
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse Platelet receptor Gi24 is produced by our Mammalian expression system and the target gene encoding Phe33-Ala191 is expressed fused with a 6His tag at the C-terminus.
Names	Platelet receptor Gi24; stress induced secreted protein 1; Dies1; VISTA; SISP1; B7-H5; PD-1H;GI24
Accession #	Q9D659
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHL QHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGS MELQVQAGKGSGSTCMASNEQDSDSITAAHHHHHH
Background	Mouse Platelet receptor Gi24(VISTA) is a transmembrane glycoprotein with homology to B7like immune costimulatory molecules. Mature mouse Gi24 contains a 159 amino acid (aa) extracellular domain (ECD) with one V-type Ig-like domain, a 21 aa transmembrane segment, and a 97 aa cytoplasmic domain. VISTA promotes both MT1-MMP expression and the MT1-MMP mediated activation of MMP-2. It supports the differentiation of embryonic stem cells (ESC) and enhances BMP-4 induced signaling in ESC, but it is also down-regulated following BMP-4 exposure. It binds to BMP-4 directly and also associates with the type I BMP receptor Activin RIB/ALK-4. It is expressed on the surface of naïve CD4+ T cells and regulatory T cells. It is up-regulated in vivo on activated monocytes and dendritic cells. VISTA inhibits CD4+ and CD8+ T cell proliferation and their production of IL-2 and IFN-γ. Its expression on tumor cells attenuates the antitumor immune response and enables more rapid tumor progression.